DPCstruct | MC10203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 137 ± 17 aa |
| Standard deviation of domain lengths | 16.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2DCN7 | 8-152 | SNFVIDRSEVDNFRSVIGDGFSLVDERAFNDLTIERYRNHAANENLILSISYKEFNVATVRLVTDSAEVMDLITKHGFSVPPPWVAF… |
| A0A3S5G483 | 2-130 | IKYNELPKIENIITSCFYGQTEQIKGHMSYKGKTLHYYKFKEFNQMVMDIITNSDDLIKKLWSNKFEPPAPDIVFPDEDFGTLGSLQ… |
| A0A4Q7S8Z2 | 5-134 | None |
| A0A2G5FM37 | 197-339 | None |
| A0A1S8CD48 | 34-187 | None |
| A0A845HG13 | 9-109 | None |
| A0A699GEH9 | 594-733 | None |
| M4WRF6 | 44-173 | None |
| A0A6N6VWP9 | 17-126 | None |
| A0A379CP08 | 66-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.