DPCstruct | MC10202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0BT07 | 8-139 | GVYVISEDEVGIVYKKFGSPLPSNRQIALNGEMGWQVDTLGPGRHFHSPLSYKVVKQKAIQIDKDEIGLVTANDGASLPTGKMFGKV… |
| A0A6P0JN02 | 8-149 | GVYVISEDEVGIVYKKFGSPLPSNRQIALNGEMGWQVDTLGPGRHFHSPLSYKVVKQKAIQIDKDEIGLVTANDGASLPTGKMFGKV… |
| A0A126QSX5 | 2-151 | None |
| A0A1E4HNM7 | 6-147 | None |
| Q114A2 | 119-269 | None |
| A0A6M0FB14 | 46-214 | None |
| A0A6M0FB56 | 107-271 | None |
| A0A7X8J9P3 | 1-124 | None |
| A0A6L9ZUR4 | 2-136 | None |
| A0A6M0BBX1 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.