DPCstruct | MC10200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6Z9S9 | 32-136 | AQKESFLYKKNWQKVNINAFVKKFASGAKGEISEDGRKIFYQSKHNNLRVVADVAGGYCRLEDTTKRGKERFLDINGNDARNYINSR… |
| A0A7T9R2L7 | 363-474 | QIPVMNGATRAMQYSSQWENASLTEAINRFAPNAKPIETSKGKVIYSNNETGVSIVYDKNGNYFRIEDTTKPRGRNYLDINGNDMNN… |
| A0A2B7YHX9 | 1-90 | None |
| A0A4P2Q8Y9 | 512-616 | None |
| A0A3E0Q2H0 | 218-330 | None |
| A0A4Q7ILN6 | 70-176 | None |
| A0A3E1NZ03 | 5-101 | None |
| A0A553XYW9 | 7-110 | None |
| A0A353GV01 | 263-370 | None |
| A0A852PUV9 | 21-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.