DPCstruct | MC102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7W889 | 4-99 | IPTHHELLDAIGQRFTFGAADGQTVDAVLSHAPAGVPMSDSFVCYAATFELPAGVALPQDVYRIGSPTGRTWDLLATPTRPTEDGRS… |
| L0GZQ6 | 1-99 | MSQQSDLSVDDFVPVVNETFKVEFEGVLSEEMTLIRATEQPRDDAQRSTTPFDLVFSAPASCSLKEGTYKVSNDKCGPYTMYLTLGG… |
| A0A4Y8ZMF1 | 86-197 | None |
| A0A2V8MDC5 | 42-148 | None |
| A0A845HQL7 | 6-111 | None |
| A0A506Y745 | 80-200 | None |
| A0A0J9E6T9 | 2-95 | None |
| A0A401V2V7 | 2-91 | None |
| A0A2V7WM25 | 2-86 | None |
| Q47VU8 | 29-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.