DPCstruct | MC10198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6VBG5 | 1-53 | MCYEVKCSTCGKTTWGGCGRHVPSVYNRLPETQRCNCKEWPGVNAPQPSTSCT |
| A0A6N2N7N7 | 25-93 | MCYKVTCSTCGKTIWRGCGGHVLSVYRGIPEGHRCLCREWPGVAPKKPNGNGAGSFSSCRNHSVKEPTQ |
| A0A540K971 | 1-62 | None |
| A0A7I8KA25 | 1-66 | None |
| A0A811MXF1 | 1-81 | None |
| A0A388LA38 | 1-74 | None |
| A0A7J7E2V3 | 1-68 | None |
| A0A3N7F5W7 | 35-107 | None |
| A0A4U5NNH4 | 1-72 | None |
| A0A6A1W5B9 | 42-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.