DPCstruct | MC10197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 69.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2N0B2 | 1-95 | MPRPGPRPYECVRRAWHSDRHKPIRGSMIGQILRMAYDTHSAATKGNREWQDKLLLVVCKAEEIMYSKANSEAEYVSQDTLWDRVND… |
| D8QRI0 | 1-95 | MPRPGPRPYECIRRAWHSESHQALRGSLTQEIFRIVTEFHRPDTRGKKEWQEKLPIVVLRAEEILYSKARTEAEYADASTLKERLDD… |
| A0A6P6TQ29 | 1-108 | None |
| A0A314Y162 | 1-108 | None |
| A0A4D6NMI9 | 1-108 | None |
| A0A5D2I1H8 | 1-94 | None |
| A0A2H5P0Q9 | 106-198 | None |
| A0A4P1RUZ9 | 1-108 | None |
| A0A835GWY6 | 53-140 | None |
| A0A2I0LG01 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.