DPCstruct | MC10194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 44.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JZC1 | 149-242 | MLLNLHKKSWMDGLMLAEYTAHCKVNETTVTEMLDLARNYNKSLEDEEKMTAEQLAIKNVGKQDPKRHLEEKVDLMMTANIVQSLGA… |
| A0A6N2MV94 | 2-93 | LLNLHKKKWTDGLTLKRFDTHSKTNEQTVQEMLNLAIKYNKAVQEEDELTPEKLAIANVGRQDAKKHLEEHVSNLMSSNIVQTLGTM… |
| A0A482SUN6 | 77-170 | None |
| A0A7C8JWZ0 | 453-543 | None |
| A0A4T0QET6 | 155-243 | None |
| A0A1D6LGD1 | 86-160 | None |
| A0A804P9V4 | 159-246 | None |
| A0A3M6VIQ7 | 589-682 | None |
| A0A6J5XFI2 | 88-181 | None |
| A0A0R3SCH5 | 217-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.