DPCstruct | MC10192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853Q0L0 | 4-72 | TMNIYAEKGHKVVFLNKNGTESQRLGARKKGLIEGHVYTVESTEVGGYSTGVYLKEFPGYSFNSVMFAD |
| A0A1C5ZBM2 | 2-60 | SVKAVFLYPENGTKYDQEKAVKCGLEKGKEYEVSHIVMGQSSTSVYLEEFKGPFNSVHF |
| A0A089L5Z2 | 1-69 | None |
| A0A847QIJ1 | 15-82 | None |
| A0A6M3J6Z6 | 2-72 | None |
| A0A1C0SX86 | 1-76 | None |
| A0A1I0WSG3 | 19-87 | None |
| A0A6N7R2H2 | 23-85 | None |
| A0A7T5UQL8 | 210-282 | None |
| A0A415ME21 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.