DPCstruct | MC10191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0376- PF14804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150KI34 | 1-58 | MKETTATGQNVEDAVNQALQELEAEKENVEIEILDEGKKGIFGLFGAKPAVVRVRLKE |
| C0BFJ2 | 1-67 | MNEITVSAKTLDDAITEASIQLGVASDQMEYDVIEKGSAGFLGIGSRQAVIRARIKKTVTEEIKAEE |
| A0A2U1E5G4 | 1-60 | None |
| A0A2N2G576 | 3-73 | None |
| A0A7C3RQJ3 | 6-68 | None |
| A0A416PEE7 | 3-69 | None |
| A0A1I0GFJ3 | 1-59 | None |
| T2RCV7 | 3-75 | None |
| A0A2G9Y439 | 5-59 | None |
| A0A243C264 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.