DPCstruct | MC10190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143XBU7 | 100-199 | AAYCYDGTPEGLLTAVFKAYELREDPLDVVREAHLQPRLGQSVRVIDTDVQLALRVQQGVRRVCGRAAADAVVSASLSDDPAAGTVV… |
| C0BCF6 | 1-114 | MKIYTCKDRLEDIMTCIYDAWADALLIGHDQIRLKKEPIFQATLLDEYIHVDGDCSKAEKVTRSIRRDISSRAYLYVYYASLSAEED… |
| A0A7C9NV69 | 44-132 | None |
| A0A328UFC4 | 7-108 | None |
| K2PTJ4 | 76-171 | None |
| A0A378TS83 | 15-122 | None |
| A0A316LSE3 | 7-113 | None |
| A0A3B8ZWS1 | 1-90 | None |
| I3C2E2 | 34-129 | None |
| A0A8B0UD51 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.