DPCstruct | MC10189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9LT11 | 14-94 | RRILPDGRIREYGKFRPSGKPGLTVGQRSVKEIDPVTGETIRVWMENYNDSGEVRIVHPYKPDDLGHLRVDPSTGKVIERW |
| A0A0F2QAV3 | 17-95 | RKELPDGRIRYYGEIQPASKPGEMVGRRIVQELNPANGNVRAWNETLDGAGRIRQVRPQLGPNKTHYTFDQFGNYTGKW |
| A0A7S6WSI8 | 2-85 | None |
| A0A246NF19 | 70-150 | None |
| A0A1Q6QIG3 | 1-83 | None |
| A0A7H1NNN4 | 137-207 | None |
| D6LJG4 | 475-555 | None |
| A0A809QCT9 | 157-236 | None |
| A0A1T4QIQ3 | 672-750 | None |
| A0A4V3BNB3 | 101-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.