DPCstruct | MC10182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8FYP0 | 2-76 | PVAEPGELTQGPGRDLFIARCSICHETPSPRAHTATGWDRVVGQMQAHMAISDVNPLSNSELDAITGYLRARAVR |
| A0A7V1EQ81 | 66-165 | GMMDGMMMGGAMPPALDPAELPEPDTTGAKLVAQYCTQCHSLPSPKQHTAAGWPATVVRMNTRMQWMSQNNSTMNITAPTSDELAIL… |
| A0A2W4IZS6 | 50-136 | None |
| A0A0A1H028 | 19-120 | None |
| A0A534W404 | 3-79 | None |
| C0N3D3 | 63-166 | None |
| A0A2M7HD83 | 51-124 | None |
| A0A3B0RZ35 | 48-131 | None |
| A0A2E8PSY0 | 20-96 | None |
| A0A1G0KNQ0 | 13-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.