DPCstruct | MC10178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 191 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833Z4J3 | 3-179 | SCVYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFE… |
| A0A075ANW0 | 538-707 | SFWVYSIKNDKWSKIYCNENMDPSYWLTMQLQEPCPRYAHQLVYDPTTKMHYLFGGNPGLVSDSKQRLDDFWELSLKRPSVEEIKSK… |
| A0A7S4P6P6 | 5-192 | None |
| A0A2S4UM99 | 1-227 | None |
| A0A0L0T3K9 | 276-449 | None |
| O13730 | 527-695 | None |
| A0A0B7NF36 | 621-832 | None |
| A0A423T4Q5 | 36-237 | None |
| E2LQZ3 | 6-207 | None |
| A0A6J1THH5 | 392-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.