DPCstruct | MC10177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0YGN4 | 71-141 | VDALLIGGGMAFTFLKAKGYEVGSSLLEEDKIDFCLQVIKKAEQKDIALYLPSDVVVAQEISPDAEAMVVS |
| A0A6A6MFK4 | 175-254 | GVIESLLGKVDILILGGGMMFTLYKAQGYSVGSSLVEEDKLDLATSLVEKAKAKGVSLLLPTDVVIADKFAADANSKTFS |
| A0A1Q9E3J0 | 722-807 | None |
| A0A287XR01 | 115-193 | None |
| A0A1B0BXA9 | 160-244 | None |
| A0A6V7PAV2 | 300-370 | None |
| A0A6P6SFZ7 | 217-287 | None |
| A0A533YJS3 | 43-112 | None |
| A0A6G1E3W9 | 217-287 | None |
| A0A6A5L6I3 | 877-961 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.