DPCstruct | MC10175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 197 ± 28 aa |
| Standard deviation of domain lengths | 27.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9KUB6 | 3-116 | QLLNINPNVRNMMESNTQLREMFQNPEFLRQLTSPETLQQLISFQQSLVSQLGQQQAGQERTQPGTAAVLPEELYATQLAQLQEMGF… |
| A0A833YKS8 | 6-176 | PLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLIPSLGSFGMPRTPAPSAGSNSGPAPEAP… |
| A0A3Q0DGP3 | 203-413 | None |
| A0A4P9VVK1 | 81-297 | None |
| A0A421JBA1 | 3-206 | None |
| A0A818FA30 | 11-229 | None |
| A0A6V7TKK4 | 3-233 | None |
| A0A820TRI3 | 311-504 | None |
| A0A669F3C8 | 16-210 | None |
| A0A7R9WPE1 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.