DPCstruct | MC10174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 137 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833YKG6 | 2-84 | EMNRLGMMVDLSHVSDTVARRALEVSQAPVIFSHSAARGVCENARNVPDDVLQLLKKNGGIVMVSLSMGVMQCNLLANVSTVA |
| A0A7J7R555 | 94-183 | MNRLGVIIDLAHVSVATMKAALNQSQAPVIFSHSSAFALCEHRRNVPDDVLQLVKQTGSLVMVNFYNDYVACKREANLSQVADHLDH… |
| A0A8B0DL95 | 294-379 | None |
| A0A820JQI1 | 95-156 | None |
| A0A6P4E8P6 | 3-88 | None |
| A0A3S0ZNF6 | 24-126 | None |
| A0A226EWZ6 | 203-289 | None |
| A0A226EZI4 | 36-140 | None |
| A0A7X5XY59 | 1-69 | None |
| A0A154PMK9 | 22-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.