DPCstruct | MC10173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 19 aa |
| Standard deviation of domain lengths | 18.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.97 |
| Pfam Score | 72.92 |
| Assigned Pfam label(s) | PF02177- PF12925- PF12924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182VRV7 | 49-119 | GPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQDRNMQMRSFAMLLPCGISLFSGVEFVCCPKH |
| A0A182M927 | 20-124 | EGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQDRNMQMRSFAMLLPCGISLFSGVEFVCCPKHFKDHGPSNYFLSWCY… |
| A0A2Y9QSU6 | 68-168 | None |
| A0A7J7J2S4 | 138-234 | None |
| A0A183TZ23 | 132-208 | None |
| A0A673K596 | 133-242 | None |
| A0A183KI84 | 2-120 | None |
| A0A7J8AE88 | 124-236 | None |
| T1EIW3 | 1-68 | None |
| A0A1I8J0B8 | 116-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.