DPCstruct | MC10171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 562 |
|---|---|
| Mean domain length (aa) | 210 ± 45 aa |
| Standard deviation of domain lengths | 45.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.47 |
| Pfam Score | 99.63 |
| Assigned Pfam label(s) | CL0063- CL0347- PF07084- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3GJ54 | 6-169 | VGCVGALKENKCLLLTFFVLLLLVLLLETTIAVLFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW… |
| A0A7E6E340 | 22-228 | LGGCGILGVGIWLAATQGNFATLSSSFPSLSAANLLIVTGTFVMAIGFVGCIGAIKENKCLLLTFFVLLLLVFLLEATVAILFFAYS… |
| A0A1A9XBI7 | 17-209 | None |
| A0A1D2NA03 | 106-454 | None |
| A0A7M3RGP6 | 3-125 | None |
| A0A287D634 | 19-194 | None |
| A0A2P8Z388 | 4-180 | None |
| A0A1A9XXA3 | 2-132 | None |
| A0A6S7G9B3 | 58-268 | None |
| A0A834Y1B2 | 2-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.