DPCstruct | MC1017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A516NXA5 | 3-94 | PNRTHLVCLRCRVSFKYPTKHGPVPCPHCRADLIDAGPHLAVPRKLDKAGWRTLTAVLDSGLTFHGGCCGTGPGYRPRTPREVRERI… |
| A0A1I0I5I5 | 7-95 | ITYKDHYACFACRKTFKRRVLRDIDRNKVMADSTPATCPECQGLMADMGKDFKSPPKDDTKAWRHLRDLYSVGITYHSCGCSGPGYV… |
| A0A1M6WG13 | 2-97 | None |
| A0A7V9RFF1 | 4-98 | None |
| A0A516W7R4 | 15-99 | None |
| A0A542MBR3 | 38-145 | None |
| A0A517Y3I7 | 11-85 | None |
| A0A845X2X5 | 2-94 | None |
| A0A4Q5Q356 | 10-115 | None |
| A0A4Q3F2K3 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.