DPCstruct | MC10169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1VPN3 | 1-63 | MGCFTYETESTSVIPPAKLFKAFILDDDNLIPKVAPQAIQKAEIIEGDGGAGTIKKITFGEGS |
| A0A6P6WZS7 | 1-61 | MGIITVSDEFTSVIPRERIFKSLIFDADNLVPKLLPQIIKSIDIAEGDGGAGTIKQMNFAE |
| I3SFW8 | 1-60 | None |
| G7JLL3 | 1-63 | None |
| A0A4Y1RCV5 | 2-64 | None |
| B9RTB9 | 1-62 | None |
| A0A498I8U2 | 156-208 | None |
| A0A151RXI1 | 1-60 | None |
| A0A7J8UB96 | 10-61 | None |
| A0A5J5AZN8 | 5-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.