DPCstruct | MC10167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 2 aa |
| Standard deviation of domain lengths | 1.89 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 58.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9NZH1 | 78-163 | SEIDRHLTVAMETLLVLVKTFGDVIRTTMGASPAIGVDLQAEQRLERCNLCYIELENIKQILVPLIRRGGAIAKSAQELSLALQEV |
| A0A6P6WYE7 | 2-84 | DRHQNISLEMLLKLVRVFGSVIYSSISAPSSVGVDIEAEQRLERCNTCFVELEKVKRCLPVLCRRGGSIAKSAHELNLALQEV |
| A0A4Y7KS17 | 127-210 | None |
| A0A2Z6PUD0 | 491-573 | None |
| A0A061E1Y6 | 771-853 | None |
| Q8GWR5 | 78-160 | None |
| A0A446IV52 | 17-97 | None |
| A0A0D9XL08 | 403-484 | None |
| A0A835AQ33 | 9-89 | None |
| A0A2P2L2L0 | 27-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.