DPCstruct | MC10166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 160 ± 19 aa |
| Standard deviation of domain lengths | 18.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6UYW3 | 7-150 | QKVFWLYYLNLEERFINTTKYVEVAKDNYSTYSIEYTSLLLSICSEIDVIFKEICGFNQNDHKCIKDYFNIVNVKFPDILKEKVAFS… |
| A0A376H3F6 | 3-168 | AYKKILNHIETEVIDLSYSISFKAEQENVYSPRIADLILRSGSLLESIIKEKYGKTDIKYDEDCIIAKLDLENKVVIVTFLDYEFPK… |
| A0A1Q6KY03 | 1-170 | None |
| K9RI30 | 36-164 | None |
| A0A1Y4KYD9 | 11-188 | None |
| A0A7Z9YWQ9 | 2-133 | None |
| A0A5B7TPI7 | 4-154 | None |
| A0A2N3RUY6 | 1-126 | None |
| A0A5C1SCH7 | 3-139 | None |
| A0A1H3EUR4 | 47-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.