DPCstruct | MC10163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5D3H3 | 49-231 | IRAFNMVCESASQYSAWHPQGKAHFDRKWPKSSRDLDQFINGGEIAGDALKKHWFSDVSPHAFISHSHKDEALAVGLAGYLLDMGIE… |
| A0A1S8P4D6 | 1-201 | MFSGFNLMLNEKDFECFSKSFDYYKNIGEKHLNEKKVSLENEIEKYINNSDDIIKGTELQKDWFPLIEEVDIFISHSHTDKELAVAF… |
| A0A4P5NVM8 | 1-197 | None |
| A0A125S3Q5 | 4-118 | None |
| A0A2S1FCP3 | 1-139 | None |
| A0A6B4L970 | 49-201 | None |
| A0A7T7M0J8 | 1-189 | None |
| A0A562J161 | 2-128 | None |
| V6T5X8 | 1-161 | None |
| C6PRP5 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.