DPCstruct | MC10160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.50 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0040- CL0126- PF04073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061H0U3 | 211-322 | SEAALPVRVFQITRKHRDEPRPRMGLLRTREFLMKDLYTFDADLASASATYDAVRGAYTRIFDRIFGARGWKSAEADTGAIGGSRSH… |
| A0A5C8X9U4 | 1-95 | MKDAYSFHADEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGGSHTHEFMALSAIGEDTIVYSKESDYAANIEKAEVVYEPN… |
| A0A2X3D0R7 | 8-115 | None |
| A0A670I5Q7 | 180-295 | None |
| A0A517LET6 | 5-119 | None |
| A0A4C1T7N9 | 207-344 | None |
| A0A6D0LZL4 | 83-184 | None |
| D3BEV9 | 470-576 | None |
| A0A3Q0ITP1 | 41-116 | None |
| A0A381GT19 | 8-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.