DPCstruct | MC10159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.69 |
| Pfam Score | 67.78 |
| Assigned Pfam label(s) | CL0040- CL0126- PF04073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P7PDS9 | 2-108 | NMADWVCGANEEGFHIRGVNWGRDLPEPDLVADIRNVVEGDPSPDGQGVLAIQRGIEVGHVFYLGTKYSKAMDATFLDVDGKPKHFE… |
| A0A5C8X9U4 | 159-300 | ELATQDEIVNLVGANPGSLGPVIDKEIKIYADNFVQDLNNLVVGANEDGYHLINVNVGRDFNVDEYGDFRFILEGEKLSDGSGVAHF… |
| T0EE83 | 157-305 | None |
| A0A7W0QSC7 | 1-126 | None |
| A0A7X8XEP7 | 317-459 | None |
| A0A6I1J2U4 | 19-147 | None |
| A0A699GE18 | 323-472 | None |
| A0A2V8QNY0 | 23-157 | None |
| A0A819E0G5 | 99-246 | None |
| A0A835FZQ5 | 880-1025 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.