DPCstruct | MC10158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 186 ± 42 aa |
| Standard deviation of domain lengths | 41.76 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7STJ0 | 4-146 | LEVLTAIFATFFFGIIFSLTGKKLIYSSFAGGLGWYTHLLFFKELAYSKTASFVISAVVITVFSEIIGRIEKTTVTSTLIPALIPLV… |
| A0A5C8X8C0 | 19-160 | IYVAKRDSSLPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEILDRKLHAQFIPEFIGSLVIGIIAVIGHTLIPTGDLA… |
| A0A848RUI0 | 109-330 | None |
| A0A5M9ZJ45 | 375-535 | None |
| A0A168J4I4 | 2-219 | None |
| A0A0H2RFP5 | 207-436 | None |
| A0A7Y5WHC3 | 23-246 | None |
| W4PBU7 | 5-108 | None |
| A0A0B8P2Y1 | 16-228 | None |
| A0A372V9Q9 | 194-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.