DPCstruct | MC10157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8X5I7 | 1-95 | MDTPKKQQFAFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMVSYIKDKVNALYTNQNIITSKSKIKYNTPKSV… |
| A0A1I4N0T7 | 100-185 | VTLKDVHIGDTLEATLSKLGQPARKDASEYGFTWYVYNQDYSSYAQIGISDNKVVALYSLSTNWSNNKGIKDGSAKSEVIKQYGNP |
| A0A380FFA5 | 14-130 | None |
| A0A7E4S1L4 | 402-495 | None |
| A0A061NT09 | 85-171 | None |
| A0A380EH86 | 1-95 | None |
| S9U536 | 65-154 | None |
| A0A0N0I7L7 | 57-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.