DPCstruct | MC10155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 211 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4Q5V6 | 74-305 | ERTLLEQFADHNLSFDERCCNVMKVAQAKLQMIKPDEVNMEDYEWWHQEYRNFRDTTVYLMVGLELFQKRNFKEALLYLICAYHKNK… |
| Q96SV4 | 21-208 | YKKWHEDYSLFRKVSVYLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHS… |
| U9TYS2 | 21-224 | None |
| A0A131YUC9 | 2-193 | None |
| A0A7F8KAK8 | 632-859 | None |
| A0A819YMR3 | 57-264 | None |
| S4RH98 | 2-193 | None |
| Q8BMT7 | 240-474 | None |
| A0A665WLU7 | 234-439 | None |
| C3Y0N9 | 24-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.