DPCstruct | MC10154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q96ND1 | 25-125 | MALLASNGCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYVKKFQSFQEHKLKISKEDSKILKK… |
| A0A7R8W9Z0 | 138-250 | WEPVFEDGKCALLSFENRFLGIGEDDETVEVKASKAGPKEMIQFRYLPRSSEDEAAEEKPEEEGKLKDVEIAFVRKFQKFQDKKLRV… |
| A0A818HB37 | 620-732 | None |
| A0A2I3HEH8 | 1-110 | None |
| A0A168JL64 | 48-158 | None |
| A0A0N4WA39 | 76-189 | None |
| A0A2J8IQ11 | 96-205 | None |
| A0A4W2C7G8 | 1-109 | None |
| A0A452EGV0 | 23-100 | None |
| A0A3R7FBG1 | 167-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.