DPCstruct | MC10149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847HZE1 | 193-308 | LPVSDAPYRLTVPYVADVAELREHLANHRVRQAVALYRQPLLPLSEAPGVVEEREGLEEELRQAVLLSRDADALCELAERLGDDLET… |
| A0A7Y5JXK2 | 18-136 | LASRPYRLVAGLAGDWLAVEAHLAAGDVASAMRAYRGPLLPRSVAPGVVRLRESIEGDVRTAILRSGRADLMSAWTRSASGADDYEM… |
| A0A358H0R8 | 1-108 | None |
| A0A6F8XVV8 | 162-289 | None |
| A0A1G9Z4X7 | 440-570 | None |
| A0A7C2FWT3 | 294-412 | None |
| A0A1G8P5R0 | 323-441 | None |
| A0A4Y4DQT9 | 126-240 | None |
| S4N1B0 | 1-101 | None |
| C8XCD7 | 396-529 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.