DPCstruct | MC10148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 102 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.09 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0105- CL0232 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5JWR6 | 16-114 | RALGYAADVRTKLSPPWTTDWITDEGRASLERFGIAPPGPTPAGESRGPVALNLSRHVVACPRCGSDDTTEIAHFGSTACKALRRCN… |
| A0A382AVR5 | 27-110 | MESQGVINYQIKTSLAPPWTTDWMSEGVKAKLKDAGIAPPSKNVICPQCDSMEVEVISNFGSTACKALYKCLSCAEPFHHFKQF |
| A0A377XTF5 | 19-90 | None |
| A0A6N7HI17 | 92-206 | None |
| A0A377M302 | 311-417 | None |
| A0A3N0GUS9 | 282-400 | None |
| A0A6G2JE46 | 59-162 | None |
| A0A7J9XC97 | 1-77 | None |
| A0A537J249 | 1-63 | None |
| A0A537JLP2 | 102-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.