DPCstruct | MC10146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 162 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF02661- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8K1N2 | 48-198 | AGYFNRLNSIHPFREGNGRTQREFMTALAKNAGHELNFDVVSAERMAQASIAGHERGDVDAFKRMFREISDPERVQALEKAQNFLTS… |
| A0A0M4LRV2 | 3-152 | QNYFLNLNYIHLFREGNGPVQRLFFYKLVEEANHKLDFFLVTNKRMTSTCIAAMGCDDFKPTQHMFEDISNPYKIDLFKKCIIHIDK… |
| A0A317E5R0 | 199-348 | None |
| A0A2L0WGP0 | 79-249 | None |
| A0A2M6URS4 | 147-340 | None |
| A0A1S6XHK1 | 273-444 | None |
| A0A5P9C252 | 129-311 | None |
| A0A7X6FT19 | 5-152 | None |
| A0A840E5R7 | 1-120 | None |
| A0A2N9MIL7 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.