DPCstruct | MC10145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 218 ± 42 aa |
| Standard deviation of domain lengths | 41.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 52.38 |
| Assigned Pfam label(s) | PF06007- PF05845 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5RPZ8 | 2-187 | MQPGFTDPVLDAQSCFRAVLEAMSRPGLVQQAGAGLTPPAPLAPATAAVLLTLADAETPIWQDAGDAAAEWLRFHAGCPLVAAPAQA… |
| A0A853B9H2 | 18-281 | LDEGAKREIRRATLTAVCVPGYQVPFGSREMPVARGWGSGGLQITLAVIGDGDTVKVIDQGDDAGVNATNLRRMISATTGCADSADT… |
| A0A377E091 | 149-435 | None |
| A0A3D9H5V1 | 8-199 | None |
| A0A7C2NBC8 | 2-238 | None |
| A0A7H4MBL4 | 7-263 | None |
| A0A7W2H3B5 | 11-196 | None |
| A0A2X2U9S6 | 4-171 | None |
| A0A381KM52 | 2-180 | None |
| A0A4R4VLB4 | 90-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.