DPCstruct | MC10141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8KJ58 | 285-413 | ATVIDESTLTPEQRLGLKQAEERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPP… |
| A0A3B3RM36 | 5-132 | SEVALTTEQQLGLRQAEERLIRDYIRRLVKRSPEYPNFQYLCTLCSAHIENIQGAHKHIKEKRHKKNIMEKQEEDELRELQPPSPAQ… |
| A0A044V1B7 | 385-492 | None |
| A0A0N5D150 | 157-283 | None |
| A0A3B4VHM6 | 28-162 | None |
| A0A3B4A277 | 30-157 | None |
| A0A667ZYM9 | 59-168 | None |
| T1FCY8 | 2-115 | None |
| A0A0S7JG01 | 151-288 | None |
| A0A4Z2BBI2 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.