DPCstruct | MC1014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 185 ± 24 aa |
| Standard deviation of domain lengths | 24.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5E2V4 | 19-217 | NSDYPVLAEDANYMAIVTPMLTLYSEVSDLAPQQEESSKQETEQKQISKVSLEENCLRITDLMVSYGYLKEFAPFKTIANCSKSCLA… |
| A0A1H9ZIK2 | 3-165 | PAQPGAVKKQTKQLLARRAAEVAAALLALADEQDDINLHTDADYTEKQLQRQPDNDLLRIGANLHRRATEHAQPLARQNVTPQEFQD… |
| A0A2H0FPK4 | 3-153 | None |
| A0A7T9GR30 | 19-193 | None |
| A0A838DFB0 | 4-140 | None |
| A0A359AU48 | 6-201 | None |
| A0A3B9ZNV3 | 36-264 | None |
| A0A3C1V9Y2 | 2-192 | None |
| A0A4V1ZQ78 | 148-341 | None |
| A0A1F3FQI0 | 21-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.