DPCstruct | MC10138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.48 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF03896- PF15056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3RCS5 | 5-131 | ANCAVLLMPVALQLMLVPLASTRKCGSIYKGFAQCLLALGDSMADSVQKDEGTQEIDTVCRSWDEFHVCANAALEGCPDEAAAVWES… |
| A0A2I0LPR4 | 1-95 | MAWQCDTIYKGFASCLISLGDSMAESVRQQREEGGEEAQELDTICKSWDDFHACATEVLSNCPEEAAAIWESLRQESRKIQFQGNLQ… |
| A0A811ZK98 | 145-265 | None |
| A0A3Q3AUX4 | 6-152 | None |
| H3BGR9 | 6-129 | None |
| U3I313 | 81-197 | None |
| A0A4W5PJ47 | 3-137 | None |
| A0A3Q2Y9S1 | 4-122 | None |
| A0A7J7V0W3 | 2-135 | None |
| A0A4X2LRG6 | 10-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.