DPCstruct | MC10136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 96.06 |
| Assigned Pfam label(s) | PF00396- CL0125- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3R687 | 7-81 | LSGLPQSSIIICDMHFFCPTGNTCCQGPTGQWGCCPYSLGQCCKDGRHCCEYGFRCDWTSLKCTKGYLQFPSAHR |
| A0A4W4H4Q7 | 4-75 | GNIRCSSYFYCPAANTCCKTLTGQWGCCPYILGQCCKDGKHCCERGYECDVTFSSCKKKGFLSIPAQLKRKA |
| A0A498LBB0 | 622-706 | None |
| A0A820J350 | 18-107 | None |
| A0A446MW92 | 88-176 | None |
| A0A4Y2CVT4 | 166-248 | None |
| A0A446MWA4 | 361-451 | None |
| A0A5P1EWU8 | 314-403 | None |
| A0A0K0DV01 | 101-195 | None |
| A0A5S6QDD0 | 44-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.