DPCstruct | MC10135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 240 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 37.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9NF02 | 90-325 | HQVTLARYGDTELRAVTPQLSEGPQRLTLVLVPAEDEEDPYMTTHVDWTAARHFWHARHTAGLRDGTDASLPDRVLLDAGLLTPDDL… |
| A6YEG7 | 1-222 | MITVRLNAGRWLALAPDEPTPVLTAAPRRDPTRPVLPDAATRTPPDLDLLRAGLVDADRLHPLVASALVPGHRRTTGSPDPATGPRL… |
| A0A066YTV5 | 3-246 | None |
| A0A810NPQ3 | 244-470 | None |
| A0A7D5BYJ4 | 151-391 | None |
| A0A6G3TGI3 | 11-256 | None |
| A0A7K0BR28 | 246-488 | None |
| A0A117MSA0 | 256-474 | None |
| A0A6N9W3N5 | 55-296 | None |
| A0A317P476 | 164-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.