DPCstruct | MC1013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1422 |
|---|---|
| Mean domain length (aa) | 163 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.45 |
| Pfam Score | 97.59 |
| Assigned Pfam label(s) | CL0125- PF13376- CL0268- PF16169- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4LFG3 | 101-271 | TIHGLPYYAQNDPRWAYTVIGGRFFSGTGCAPTVITSIVNYYLNANLTPYQIGLELNRLGYFNTDVLAGTSSDCWNWVSSNYGFNIK… |
| A0A1G2EXB2 | 15-161 | PDMKKLKIPYYRQETDYFCGPAALKMALEFFGKKVSQKKLAGLLKTNEKRGTLRRDMIKTARGFGLSARGFFGKNLDEVKKFLNTGN… |
| A0A6L3F270 | 248-448 | None |
| A0A5Q2RLK1 | 656-829 | None |
| A0A6L7ABI5 | 310-472 | None |
| A0A2E8K291 | 9-167 | None |
| A0A822E1J4 | 6-132 | None |
| A0A7J0FUM6 | 11-143 | None |
| A0A7Y5SGY9 | 262-460 | None |
| A0A7Y4ZNT6 | 110-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.