DPCstruct | MC10129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 138 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2G0E7 | 1-146 | MQHLIKKHVLNGEFDLVRQLMSETDFMEFEEAYISSAHEVESMMFYTCILDMIKYEESSEMHDLAFLLLVYPLSEYEGALDSAYYHA… |
| A0A7X8MG15 | 1-129 | MIKKIKELILRGEFLEARVTMDCITKEELEIAIFEIGCDEESICAYSFICFLLLEKESVEYHCLASKLLNIAFPHIYGGYQTSLYHI… |
| A0A1K1N8K1 | 6-127 | None |
| A0A0R2MXH0 | 24-149 | None |
| A0A3P2RD37 | 6-149 | None |
| A0A495J3E0 | 1-146 | None |
| A0A544U7P6 | 553-679 | None |
| A0A1V5K9T2 | 177-327 | None |
| A0A510KPU8 | 40-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.