DPCstruct | MC10126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7PJP5 | 3-111 | ERIELENGLILEIWDYSRKIAGDRWLVGFLAQISVTPSKEDFSNEFYYEYFLQNTDGKLYYRYHKERTFVPEKEVPEIYKSIKENFL… |
| A0A1W1HAM2 | 1-125 | MKNSIAMKEKFIKEMELDNRQSVKIFDISRKISVDAYLVAMVARINIAIDNELFTEEQLQNISFDDIINKLGSHVQFEYKKERNFIM… |
| A0A1V5DYL1 | 59-179 | None |
| A0A1F9PHW3 | 7-132 | None |
| A0A2N6F1A1 | 1-114 | None |
| A0A533SQR5 | 1-102 | None |
| A0A1I4VY19 | 1-125 | None |
| A0A7C5QAK8 | 1-125 | None |
| A0A7C5AK74 | 1-97 | None |
| S0G5N2 | 23-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.