DPCstruct | MC10124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3N5H7 | 26-115 | TMIEIEYIVKDSRGVERLRTADKKAADAYDRILENAERLAQLLRADQVLPNLPETDLENLTIYLARNAREVEQILKGKPMEREQTPP… |
| A0A1W1H4N8 | 1-90 | MAVIIKYVVVRNGDEKMTFATKKEADAYDKMLDIADHLYDFLEEEELPLDEIQKESVSMAMARNADTIIKIMRGMKIKKQLVRKKAG… |
| V0AWW8 | 41-130 | None |
| A0A382C107 | 41-133 | None |
| A0A495AE13 | 1-90 | None |
| A0A290T255 | 1-77 | None |
| A0A2N0WXY9 | 1-88 | None |
| A0A0A3YIH6 | 1-103 | None |
| B7LPJ6 | 50-139 | None |
| A0A6S4ZUF4 | 29-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.