DPCstruct | MC10123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250DJK9 | 1-70 | MTHTCHAEGCNKAVPPKYLMCGKHWAMVPLTQQREIWRHYRPGQEVDKRPSTEYLRVMKIAVDLVARAEG |
| A0A286ATF5 | 1-69 | MRHLCHWPGCQVEVPPAKWGCTPHWYQLPKALRDQIWATYRPGQEITKTPSRAYIEAAQAVQAWIKEHG |
| A0A4Q5NMU8 | 96-164 | None |
| A0A367FBG7 | 4-73 | None |
| A0A653JWJ7 | 2-63 | None |
| A0A859PWZ3 | 13-89 | None |
| A0A2P1QRX0 | 1-77 | None |
| A0A1T5AC25 | 94-168 | None |
| A0A836Q0N5 | 8-84 | None |
| A0A522DLK7 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.