DPCstruct | MC10120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0V1J5 | 1-83 | MASQNFDTPIPCCNVSPGLVSADDKSSWCQANLNTCTEVCGGQGQTSGNTCDRTSLNYSCKCSNGTDITSALAAYSFTVPGQM |
| A0A6A7C8L0 | 16-112 | AQNNSTGAGAAGAAAPTSGAAGGAGAANLPAGFDPNSVPRDLRMAWCRAQMNTCRQVCNGQAYPNNCNSDTLVWQCTCTDGSKPNIS… |
| R1GC84 | 2-97 | None |
| A0A0J6YAX1 | 1-94 | None |
| A0A1B8EI01 | 1-102 | None |
| A0A2U3EEJ9 | 528-638 | None |
| A0A2K1QZM7 | 1-104 | None |
| A0A5N5KJY3 | 127-226 | None |
| A0A1X7RZJ8 | 102-197 | None |
| K1X3H6 | 52-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.