DPCstruct | MC10119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 249 ± 22 aa |
| Standard deviation of domain lengths | 22.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 64.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0AE71 | 1-276 | MSTPSNVPRPPPSWWKRTAVALLPNYFVSRFKLDDAPHGSRHAMGGGIGNDGVFNNITAKPSTSGVRVQDGDNIYIVPEESSAIPPP… |
| C5MA09 | 1-259 | MQTNNGRFIGQGTDGVFRNLMAKPDTEEMRQEQELNPPSYEEAAADASPEYWESTMISPMYEDEVFVQGLPVGNIANFVWNALVTVA… |
| A0A1G4KAT4 | 1-277 | None |
| A0A401H1M3 | 743-1008 | None |
| B8P377 | 809-1050 | None |
| A0A178ESE7 | 117-370 | None |
| F2UBB6 | 20-245 | None |
| A0A4P7NFK4 | 131-350 | None |
| A0A1E3QWI4 | 518-734 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.