DPCstruct | MC10118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 209 ± 20 aa |
| Standard deviation of domain lengths | 20.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5VQQ5 | 9-194 | ADSAKGKGGGPRGGKPVDAIRHKDKRPNIPTEELRDFVADDENAPKTMLYPRDPSLDPQLVWKGKDEQDRADLAVPVVPIYIQEKIH… |
| U7GT18 | 19-232 | KTRKKSEKKPQPTKNVELGTEIISYRHLDKRVNNPEVGMVTPFTDPDVGKIRWKYDPHIDPSLQFDSQRAWTENLIDDALASNDPEQ… |
| A0A3A0BYF7 | 76-307 | None |
| A0A1S9CYP4 | 1-178 | None |
| M1YIR7 | 1-197 | None |
| A0A171JXF7 | 1-195 | None |
| A0A451B1R3 | 2-230 | None |
| A0A6S6PUR3 | 68-311 | None |
| A0A0T6AIF6 | 1-204 | None |
| A0A261VVY4 | 2-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.