DPCstruct | MC10116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 160 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16078 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397B5B3 | 11-165 | SRLLRRTFVQANSPHHARAFSSSPHPSESFLSGTNNVYVEEMYKTWSKDPTSVHKSWDVYFRQVDQGAVPGEAFIPPPTVQSGVTPV… |
| A0A1V9Y0I7 | 12-188 | SPALRAASVGRIPCVASGPSAFAVGLNRGRFVYQLPCQCTGSYQQLASYQTRAAQEPFLNGSSGVYVEEMFRAWKADPNSVHKSWDV… |
| A0A401RPY0 | 1-154 | None |
| A0A4U5NG49 | 119-294 | None |
| A0A6G0TQZ6 | 10-176 | None |
| F6UHA9 | 29-189 | None |
| A0A7J8D7E7 | 3-156 | None |
| A0A2P8Y1F7 | 1-162 | None |
| A0A1Y3EDB3 | 20-170 | None |
| A0A2D4CF32 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.