DPCstruct | MC10115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 573 ± 51 aa |
| Standard deviation of domain lengths | 50.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7TI60 | 66-573 | LVYQSKFSLTLEEDAQFSVVKRFEQHIATSTAPAKNILQSMLANLYWEYFKANRWKLYNRTQSIVKNDKTDFRTWDLTTLFSEINHY… |
| A0A5C9C7N3 | 82-669 | FVIHTVYGCQVVVTNPTSARQKLTVLLQVPKGAIPVANGQQTRSVHVDLQPYHTQTLDYFFYFPGAGQYPHFPVHVAKNGELIAFAT… |
| A0A2E9F4H3 | 366-995 | None |
| A0A1W9N247 | 359-896 | None |
| A0A1J5CZ12 | 722-1269 | None |
| A0A2E9RRB0 | 1-537 | None |
| A0A0V0QAV1 | 534-1136 | None |
| A0A6G0X251 | 420-987 | None |
| A0A077ZQS0 | 571-1225 | None |
| A0A090QBH7 | 72-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.