DPCstruct | MC10113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 6.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355G9E5 | 1-107 | MSFADYRKPVPGSSRQSWALARQQISKKLDSVEGKHLILVKYNRDHSHHDEWVYNEADIDNSKVVWARILEPKKNSDLISYFNDRSI… |
| A0A2V9S7A4 | 103-224 | RAIPAICVTMFLLRVSAATLHIPLTRSRAAAWYQAERLTPGRSEILSELQRLPGEQLVIVRYNPHRIPDEEWVYNQADIDSAKIVWA… |
| A0A3C1X9E0 | 27-145 | None |
| A0A3A8NJU6 | 191-297 | None |
| A0A1Q6XF51 | 12-130 | None |
| A0A3D2TNG3 | 46-153 | None |
| A0A7Y5HBI3 | 270-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.