DPCstruct | MC10112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 644 ± 46 aa |
| Standard deviation of domain lengths | 45.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4KKQ9 | 1-605 | MSAADVGQVIAQAVAQARAGNAVATIAVVDRVGNVLGVYAMSGSARDVRVASTPAGAPTIDGGLEGIVLPAAVGGPALAAIAKAVTG… |
| A0A538S4M7 | 251-865 | TLTAAEVGTLLQRAAAASASHDAIIAIVDRAGNPLGIRVESGVSPTLLGNAALKTFAIDGALAEARTAAFFANDSGGGTPLTSRTIE… |
| A0A3L7TUV4 | 8-652 | None |
| A0A517XPI0 | 337-940 | None |
| A0A142WYU3 | 393-1036 | None |
| A0A517YEB9 | 50-752 | None |
| A0A2E3MLS3 | 107-767 | None |
| A0A3L7QSE6 | 195-840 | None |
| A0A517QXV6 | 269-922 | None |
| A0A2E7D615 | 462-1201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.